GenomeNet

>sis:LS215_0369 pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein (EC:1.2.7.1); K00169 pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1] (A)
MTEVKKLVEKEVLMNGTQAVAHAAMYADVDVVAAYPIRPYTEVMDTISKLIADGELDAEF
IVAEGEHGQFETVKHASLVGARTLVGSSGVGWLYGMEAIVVTATDRAPVVAIIGNRALDD
PGAYGVEHNDALMVRDVGWLLVWVDTAQEAFDTTLIAYRVAEDQRVLLPLGISMDGGFLT
HSEQIVRLPPKELVKNFLPPYNRGKYLVHPDNPITVAPQVNEDWVMEIRRQHEEAMERAR
GVIVEAYEEFKKVFGRYPGSTNELQMPENPFVEPYMVDDAEVVLIGMGTVSKPMKVAIKS
MRRQGYKVGMLRIRWFRPFPTQDVIKYLANSRVVCVVDRDYSMGSPNRGGVIYHEIRSSL
YDLDQRPRVMSFIGGLGGREITIQDVKKIIKIGYEHRDTPITKPVYWVGVRGDPW

BLAST