GenomeNet

>sis:LS215_2831 hypothetical protein; K00113 glycerol-3-phosphate dehydrogenase subunit C [EC:1.1.5.3] (A)
MYSLNPSNPTFFDSDKLLSEFIRQASVCHGCRLCFNYCDSFPLMFTYTDKKGPKNLTLDD
LFNVASKCFHCKMCYVNCPYVPPHEFNMDFPSLMEWAWLYYKKKRGLTVRDFIFEMLDGV
KFARPLAKVIMEKNKELLGIHKEAPTLPVAEKGLRERVKQRTIDNPKAKVALFPTCLIEN
FFPEIGEDLIELYNELGIEVIIPNFVCCGAPMLDSGDVDRLKKNAEYNTKIIEDLVKKGY
DVVSPIPTCTLMIREYKKILDNEIPKVYDAMEYLFKLKNEGKIELKGKIEKNVYYHPPCH
LKFLQVGLPGVRLLRSMGAKVDISNNGCSGIDGGWGLRNYDTAKRVGSKMMEAFKQSKAD
LFSTECPLAGLQIEKSSGRRPLHPIQLLKEAMKNG

BLAST