GenomeNet

>siu:SII_0015 K01186 sialidase-1 [EC:3.2.1.18] | (GenBank) nanA; neuraminidase A protein (A)
MNWSFFDWKKQDKIRKLVVGTTFIVIGIAIFLALSGLKQVNTVLANTKKVESGINNSIAD
LLKETNVIPRDYYARQLENVQTIFEKENVVTNDSNNQRIDLSGELDKLKQLQTATIHIEF
KADANAPRFYNLFSVSSDKVKNEYFTMAVYNNTAIVEGRDKDGKQFYNSYNDAPLKIKSG
QWNSVTFTVDGPNSDHPNGQVRLYVNGVLSRTSKLSGRFIKDMPDVNHVQIGKTNRAGSM
MWGSNLQVRNLTVYNRALTSEEVQKRSQLFKRSDLEKRLPEGALLTEKTDVFKSGYNNQP
NSEGINSYRIPALLRTDKGTLIAGADQRRLHHADYGDIGMVVRRSEDNGKTWGDKRVLSN
LRDNPDAKDPVAPSPLNIDMTLVQDPTTKRIFAIYDMFPEGKGIFGMPKNNEKAYEQVGD
KTYQILYKQGEFGHYTIRENGEVYDANNQKTDYRVVVNPTKADYRDKGDIYKGQELVGNI
YFAQSKKNPFRIAYTSYLWMSYSDDDGKTWSAPRDITSGVRKDWMKFLGTGPGTGIVLRT
GKHKGRILIPVYTTNNVSHLNGSQSSRLIYSDDHGETWHAGEAVNDNRQVGGQKIHSSTM
NNRNAQNTESTVVQLNNGDIKLFMRGLTGDLQVATSKDGGATWEKEIKRYPQVKDVYVQM
SVIHTMHDGIEYVVLSNAGGPERTNGLVHLARVEKNGELTWLKHNLIQKGEFAYNSLQDL
GNGEYGLFYEHRENGQNPYTLSYKKFNWDFLSKDLISPKEVKVKKAVDRGKGVVGLEFDS
EVLVNQAPTLKLTNGKIATFITQYDSKTLLFKVDKGAIGQKITGLASGSIESIHNLPVNL
TGASIPGGVNGDKGTVNEVPEYKEKKSTKKPATEKKQTNKVLTNHHNLPSTGSTTNVPVL
FLGIATIILGLLTMINKRKQ

BLAST