GenomeNet

>siv:SSIL_2188 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) predicted eukaryotic-type DNA primase (A)
MKPMLLTDVPDIPLGDDWLYEAKYDGYRCILVWDKGKNIPEMKSRNGNVLNEKFPEIIRF
CKSIYAEIEPYLPLIFDGEIVYLINHFQSKFSFVQKRGKMTNQKNIESNAKTFPCHYIVF
DLLKLKGKDKGNSRLTTRKQLLSDLFERLNLLDTVQYNDPKRLQAIDVFEDPHLIWQKVT
SHNGEGIIAKKRSSKWLENTRTKSWQKIKNWKHVNVILTKFDQLNGFFNGAIYQEDMLME
VVSFKHGLSEEESKTLIAFFKSKGTVKEKSIFEIPPSICVTVACIDFDGSKLREPRFHSF
QHHLDVTECNWQQMQRQLNPIPESVIVTHPDKPVFPASHITKDDYLYYLQTVAPMMMPFL
QDRLLTVIRYPHGVPGESFYQKNYIENLPEFITTQLVDDTHFILCNNLESLLWLGNQLAL
EFHIPFQPVTSEQPTEIVFDLDPPSVHEFGLAVDAAVKFKTIMDYFKLTSFIKTSGGKGM
QIYIPLPLHTFSYEDTGVFTEFICRFLVQQFPNSFTIERLKKNRGKRLYLDYVQHREGKT
IVAPYSPRGNNKGLIATPLLWEEVNEGLTPDLFTIPNIIKRLERMADPFKNFREVGERQP
FRAALDQITGKQV

BLAST