GenomeNet

>siv:SSIL_2188 DNA primase; K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MKPMLLTDVPDIPLGDDWLYEAKYDGYRCILVWDKGKNIPEMKSRNGNVLNEKFPEIIRF
CKSIYAEIEPYLPLIFDGEIVYLINHFQSKFSFVQKRGKMTNQKNIESNAKTFPCHYIVF
DLLKLKGKDKGNSRLTTRKQLLSDLFERLNLLDTVQYNDPKRLQAIDVFEDPHLIWQKVT
SHNGEGIIAKKRSSKWLENTRTKSWQKIKNWKHVNVILTKFDQLNGFFNGAIYQEDMLME
VVSFKHGLSEEESKTLIAFFKSKGTVKEKSIFEIPPSICVTVACIDFDGSKLREPRFHSF
QHHLDVTECNWQQMQRQLNPIPESVIVTHPDKPVFPASHITKDDYLYYLQTVAPMMMPFL
QDRLLTVIRYPHGVPGESFYQKNYIENLPEFITTQLVDDTHFILCNNLESLLWLGNQLAL
EFHIPFQPVTSEQPTEIVFDLDPPSVHEFGLAVDAAVKFKTIMDYFKLTSFIKTSGGKGM
QIYIPLPLHTFSYEDTGVFTEFICRFLVQQFPNSFTIERLKKNRGKRLYLDYVQHREGKT
IVAPYSPRGNNKGLIATPLLWEEVNEGLTPDLFTIPNIIKRLERMADPFKNFREVGERQP
FRAALDQITGKQV

BLAST