GenomeNet

>siy:YG5714_0373 K00170 pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1] | (GenBank) thiamine pyrophosphate protein domain protein TPP-binding (A)
MSSLVTPKRIPKFYRGNAACPGCPIPKELDVLLEVLGNKTVLVVPASCTTIIMGDTSGMP
STVPVIHSAFGAPAAIASGIVRALRTRGDKDVIVTVWAGDGSTGDIGFASLSGAAERNED
ILYVCYDNEAYMNTGIQRSSLTPKGAWTTTTPEGKREYKKPLPFIIAEHKVPYVATASIA
YIYDYEAKVRKAKQIRGFRYLHLLSPCPPGWRFDSKLTIDTAKLAVETGVWPLFEIENGE
FRLTSVSKTLLDKKNRKPVAEYLKLQGRFKQLTEEEIKGIQEEIDEMWQEIKKLVKK

BLAST