GenomeNet

>siy:YG5714_0373 2-ketoisovalerate ferredoxin oxidoreductase subunit beta; K00170 pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1] (A)
MSSLVTPKRIPKFYRGNAACPGCPIPKELDVLLEVLGNKTVLVVPASCTTIIMGDTSGMP
STVPVIHSAFGAPAAIASGIVRALRTRGDKDVIVTVWAGDGSTGDIGFASLSGAAERNED
ILYVCYDNEAYMNTGIQRSSLTPKGAWTTTTPEGKREYKKPLPFIIAEHKVPYVATASIA
YIYDYEAKVRKAKQIRGFRYLHLLSPCPPGWRFDSKLTIDTAKLAVETGVWPLFEIENGE
FRLTSVSKTLLDKKNRKPVAEYLKLQGRFKQLTEEEIKGIQEEIDEMWQEIKKLVKK

BLAST