GenomeNet

>sjj:SPJ_1755 type II restriction enzyme (EC:3.1.21.4); K01155 type II restriction enzyme [EC:3.1.21.4] (A)
MELHFNLELVETYKSNSQKARILTEDWVYRQSYCPNCGNNPLNHFENNRPVADFYCNHCS
EEFELKSKKGNFSSTINDGAYATMMKRVQADNNPNFFFLTYTKNFEVNNFLVLPKQFVTP
KSIIQRKPLAPTARRAGWIGCNIDLSQVPSKGRIFLVQDGQVRDPEKVTKEFKQGLFLRK
SSLSSRGWTIEILNCIDKIEGSEFTLEDMYRFESDLKNIFVKNNHIKEKIRQQLQILRDK
EIIEFKGRGKYRKL

BLAST