GenomeNet

>ske:Sked_12890 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) thymidine kinase (A)
MAKLYFRYGAMNSGKSTALLQAAYNYEERGHQVLLAKPGIDTKAGRAIQSRLGFDRDVDF
MVGEGQDAYALFQQHRAHVQTESGRDVSCLLVDESQFLSAGQVNDLLRIATLDSIPVICY
GIRTDFQTAAFPGSRRLLEIAHSLEELKTICRCGRKAIFNARSVDGVFTFDGAQVAIDGV
EVGYESLCAACYLRESGGHLTR

BLAST