GenomeNet

>sln:SLUG_03880 aminotransferase family protein; K00823 4-aminobutyrate aminotransferase [EC:2.6.1.19] (A)
MSKAAQLIEEDGKYFAKSGRIKYYPLVIDHGYGATLVDVDGKSYIDLLSSASSQNVGHAP
KKVSDAIKAQVDKFIHYTPAYMYHESAVKLSKKLCEIAPGNFEKRVTFGLSGSDANDGVI
KFARAYTGRPYIISFTNAYHGSTFGSLSMSAISLNMRKHYGPLLNGFYHIPFPDNYRGMF
EQPTANTVAEYLAPLKEMFAKYVPADEVACIVVETIQGDGGLLEPVAGYFEALAALCREH
GILIAVDDIQQGLGRTGTWSSVEHFNFIPDMITFGKSLAGGLPMSALVARKEIIDSLEAP
AHLFTTGANPVSCEAALATIEMLEEDDLLSESVNKGRYVRQRMEQWTSRYEYVGDVRGIG
LSIGIDIVSNKQNKTRDPEAALKICNYCFEHGVVIIAVAGNVLRFQPPLVITYEQLDEAL
ATLEQALQGLQDGQLDTLDIDGQGW

BLAST