GenomeNet

>sly:3950383 K02965 small subunit ribosomal protein S19 | (RefSeq) rps19, LyesC2p029; ribosomal protein S19 (A)
MTRSLKKNPFVANHLLKKIDKLNTKAEKEIIVTWSRASTIIPTMIGHTIAIHNGKEHLPI
YITDSMVGHKLGEFAPTLNFRGHAKSDNRSRR

BLAST