GenomeNet

>smc:SmuNN2025_0950 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) kitH; putative thymidine kinase (A)
MVKWIRYQFEMGMTVLAQLYYKYGTMNSGKTIEILKVAHNYEERGKPVVIMTSSLDTRDG
FGVVASRIGMRREAVTITDDMDIFAYIENMFKKPYCILIDESQFLSQKNVYDLARIVDEL
DVPVMAFGLKNDFQNHLFEGSRELLLLADKIEEIKTICQFCSKKATMVLRTENGRPVYKG
NQIQIGGNETYIPVCRRHYFHPPIKA

BLAST