GenomeNet

>smc:SmuNN2025_0950 kitH; thymidine kinase; K00857 thymidine kinase [EC:2.7.1.21] (A)
MVKWIRYQFEMGMTVLAQLYYKYGTMNSGKTIEILKVAHNYEERGKPVVIMTSSLDTRDG
FGVVASRIGMRREAVTITDDMDIFAYIENMFKKPYCILIDESQFLSQKNVYDLARIVDEL
DVPVMAFGLKNDFQNHLFEGSRELLLLADKIEEIKTICQFCSKKATMVLRTENGRPVYKG
NQIQIGGNETYIPVCRRHYFHPPIKA

BLAST