GenomeNet

>smd:Smed_0571 K00799 glutathione S-transferase [EC:2.5.1.18] | (RefSeq) glutathione S-transferase domain-containing protein (A)
MLKLFYTPGTCSLASHIALEEAGAAYEVHRVDFSKAEQTKPDYLSINPKGRVPALVTDRG
ILTETPPILAYIAQSFPKARLAPLDDPFEFARLQSFVSYLCSTVHVAHAHARRAGRWADD
PAAQEAMKAKVPQNMGDCFALIERTMFAGPFVLGDSYSIADPYLFTIASWLESDGVDPAR
FPRILDHRNRMGERQAVAKVLAAVQA

BLAST