GenomeNet

>smd:Smed_3724 K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] | (RefSeq) RuBisCO-like protein (A)
MIHITYRIETPGDVEALARKIASDQSTGTFVAVPGETEELKRRAAARVVAIRHLPPADRA
SLPDEAGDATRFNRADAEIAYPLEAVGTDLSALMTIAIGGVYAIKGMTGIRVVDMKLPPE
FAAAHPGPQFGVAGSRRLTGVEGRPIIGTIVKPALGLLPDETAALVGDLLSSGVDFIKDD
EKLMSPAYSPLSARIAAIMPKIRDHEQKTGKKVMYAFGISHTDPDEMMRNHDLVVAAGGN
AAVVNINSIGMGGVAFLRKRSNLVLHAHRNGWDILTRHGGLGMEFSVWQQFWRLLGVDQF
QINGIRVKYWEPDDSFVKSFKAVSTPLFSREDCPLPVVCSGQWGGQAPETFVRTGRTTDL
LYLCGGGVVSHPGGAGAGVRAVRQAWEAAVAGIPLSDYAKEHPELAQSIEKFADGKGA

BLAST