GenomeNet

>smd:Smed_4038 K05343 maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1] | (RefSeq) alpha amylase catalytic protein (A)
MNEAPWFTSSVIYGIDVRRFADGNGDGIGDFIGLRERVVYLSHLGIDCVWLSPFFRSPFA
DNGYDVSDYYSVDPALGTLDDFLNFLHAAGEHGIRVIIDLVANHTSSEHPWFQAARRDAR
CRFRDYYVWSASPPPVAPDNKTAFPGEESSVWTYDELAQAYYFHKFRHFQPDLNIANPAV
RDELLRVVDYWLTLGVDGFRVDAAPFVIGETGIEHADPRDPHGFLREMRELVEGRRRDGL
LLGEADLSPEKLRPYFGEGKLDLLFNFVLSASFAASLARQKADLIGQALSIMPEPPPHRG
WVNFLRNLDELNLDRLPEDIQQETFAAFAPDEEMRIYGRGIRRRLAPMLEGNQTRLELAF
SLLLSSPGVPLVLYGDEIGMGEDPSRPGREPVRVPMQWNAGANAGFSTAQRARLIQPIVT
DGPFAFKRINVEAQREDPRSLLNRVRAMILMRRSHKLFQRGRPIVLHTRDPALFALAYSD
GTELFVVLHNLTEAKRRAEVELPGAIDARLKDVFGEGEVELSGQHLTMGLGPFGYAWLHS
GRKD

BLAST