GenomeNet

>sme:SM_b20197 cbbS; ribulose-1,5-bisphosphate carboxylase small subunit protein (EC:4.1.1.39); K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] (A)
MRITQGCFSFLPDLTDEQITAQVQYCLGKGWAIGVEYTDDPHPRNTYWEMWGNPMFDLKD
AKGVMMELEDCRKAHPQDYIRLNAFDSSRGLETVTMSFIVNRPENEPSLRMTRTESNGRS
QHYMWETQR

BLAST