GenomeNet

>sme:SM_b20197 K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] | (RefSeq) cbbS; ribulose-1,5-bisphosphate carboxylase small subunit protein (A)
MRITQGCFSFLPDLTDEQITAQVQYCLGKGWAIGVEYTDDPHPRNTYWEMWGNPMFDLKD
AKGVMMELEDCRKAHPQDYIRLNAFDSSRGLETVTMSFIVNRPENEPSLRMTRTESNGRS
QHYMWETQR

BLAST