GenomeNet

>sme:SMc02597 sodC; superoxide dismutase Cu-Zn precursor (bacteriocuprein) transmembrane protein (EC:1.15.1.1); K04565 superoxide dismutase, Cu-Zn family [EC:1.15.1.1] (A)
MMRTMIAIACAAGMAGAASAQQSSQTATAEFVGKDGTDIGRATLTAGGKGVLIEMEISGL
PKDTWVAFHAHEMGRCDPKDGFESAGKHFAGEDENAEHGFLASNGPHAGDMPNQYVGADG
TLRAQVFNSFVSLDDRATALRGRALVIHVHSDDNRSQPSGDAGDRLACAVVK

BLAST