GenomeNet

>sme:SMc03959 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (RefSeq) hypothetical protein (A)
MAARNEPLSEYNRRRDFTRTSEPKGAVARRSGDNRMRFLVQKHAATRLHYDFRLEWEGVL
KSWAVTRGPSLNPEDKRLAVRTEDHPLAYGDFEGTIPKGEYGGGTVMLWDTGWWEPEDDP
SKALKKGKLSFKLHGSRMKGGWALVRMRPREGEKRENWLLVKETDDVASDDGESLINENI
TSIVTGRTMEEIAEGRGEKRARVWHSNKSISANLKAGAIAENGNAGKRATRKASGKLPAF
KAPQLATLVTKVPAGDAWLNEAKFDGYRLVCAVGAGTVRCYTRNGLDWTEKFPAIAAALA
ELDCQSALIDGEVVALSEGGSTFSALQKALRTGASTRLYAFDLIELDGKDLSRKPLVERK
ERLEALLQTLGATSTVQFSEHVRGNGEHVLSAICKAGQEGIIAKEADAPYRSGRSRSWLK
VKCTKRQEFVIGGYTPSSKKGRAFASLLVGTFEGGKLIYRGGVGTGFSGKTMEDLAAAFA
KRKRDTSPFDSVPRERMRNSVWLEPDLVAEVDFAEFTADGHVRHGSFEGLREDKEARAVK
LETPKPAEAEPETAKSKSSARTRKTPPVQGDADVLGIRISHPDRVLFEGQGITKIDLARY
YAVVAERMLPFAADHPVSLVRCPQGGERHCFFQKHASDGFPEAIREVPITESSGDTENYM
YIHDAKGLVAAVQMGTLEFHIWGSSIDRLEKPDRLVFDLDPDPSVDFETVKAAALRLRDE
LAEIGLKTVPMVTGGKGVHVIVPLRPHAEWEEAKGFAKALARSIAERDPDNFVATMSKAK
RKGKIFIDWLRNDRGATAIAPYSTRARSGGPVATPVGWDELQGLEAANGFQIPDIIERIE
AGTDPWREIGKISQSLTKKILNSVE

BLAST