GenomeNet

>smeg:C770_GR4pD1209 K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] | (GenBank) Ribulose 1,5-bisphosphate carboxylase, large subunit (A)
MQRALPVIRITYRIETPGDVEVLAKKIASDQSTGTFVPVPGETEELKARVAARVVAIRQL
EPADRASWPDEAGSATRFNRADAEIAFPLDAVGTDLSALMTIAIGGVYSIKGMTGIRIVD
MKLPPEFAAAHPGPQFGVVGSRRLTGVEGRPIIGTIVKPALGLRPEETAVLVGELLSSGV
DFIKDDEKLMSPAYSPLSARIAAIMPRILDHEQKTGKKVMYAFGISHTDPDEMMRNHDLV
VAAGGNAAVVNINSVGMGGVAFLRKRSGLVLHAHRNGWDILTRHGGLGMEFSVWQQFWRL
LGVDQFQINGIRVKYWEPDESFVKSFEAVSTPLFTKDDCPLPVVGSGQWGGQAPETYART
GHTTDLLYLCGGGIVSHPGGPGAGVRAVRQAWEAAVAGIPLADYARDHPELAQSLEKFAD
GKGA

BLAST