GenomeNet

>smeg:C770_GR4pD1397 Ribulose 1,5-bisphosphate carboxylase, large subunit (EC:4.1.1.39); K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MNADAKTEIKGRERYKAGVLKYAQMGYWNGDYEPKDTDLIALFRITPQDGVDPIEAAAAV
AGESSTATWTVVWTDRLTACDQYRAKAYRVDPVPGTPGQYFCYVAYDLILFEEGSIANLT
ASIIGNVFSFKPLKAARLEDMRLPVAYVKTFRGPPTGIVVERERLDKFGKPLLGATTKPK
LGLSGKNYGRVVYEGLKGGLDFMKDDENINSQPFMHWRDRYLYCMEAVNHASAVTGEVKG
HYLNITAGTMEEMYRRAEFAKELGSVIVMVDLIVGWTAIQSISEWCRQNDMILHMHRAGH
GTYTRQKNHGISFRVIAKWLRLAGVDHLHAGTAVGKLEGDPPTVQGYYNVCREMKNEVDL
PRGLFFEQDWADLKKVMPVASGGIHAGQMHQLLDLFGDDVVLQFGGGTIGHPMGIQAGAT
ANRVALEAMVLARNEGRDIAHEGPEILRAAAKWCKPLEAALDIWGNISFNYTPTDTSDFV
PSVTAA

BLAST