GenomeNet

>smeg:C770_GR4pD1398 Ribulose bisphosphate carboxylase small subunit (EC:4.1.1.39); K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] (A)
MRITQGCFSFLPDLTDEQITAQVEYCLGKGWAIGVEYTDDPHPRNTYWEMWGNPMFDLKD
AKGVMMELEDCRKAHPQDYIRLNAFDSSRGLETVTMSFIVNRPENEPSLRMTRTESNGRS
QHYMWETQR

BLAST