GenomeNet

>smeg:C770_GR4pD1398 K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] | (GenBank) Ribulose bisphosphate carboxylase small subunit (A)
MRITQGCFSFLPDLTDEQITAQVEYCLGKGWAIGVEYTDDPHPRNTYWEMWGNPMFDLKD
AKGVMMELEDCRKAHPQDYIRLNAFDSSRGLETVTMSFIVNRPENEPSLRMTRTESNGRS
QHYMWETQR

BLAST