GenomeNet

>smel:SM2011_b20393 K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] | (GenBank) rbcL; Putative ribulose bisphosphate carboxylaseoxygenase,large subunit (EC:4.1.1.39) (A)
MLRITYRIETPGDVEFLAKKIASDQSTGTFVPVPGETEELKARVAARVLAIRHLEPADRA
SWPDEAGSATRFNRADAEIAFPLDAVGTDLSALMTIAIGGVYSIKGMTGIRIVDMKLPPE
FAAAHPGPQFGVVGSRRLTGVEGRPIIGTIVKPALGLRPEETAVLVGELLSSGVDFIKDD
EKLMSPAYSPLSARIAAIMPRILDHEQKTGKKVMYAFGISHTDPDEMMRNHDLVVAAGGN
AAVVNINSVGMGGVAFLRKRSGLVLHAHRNGWDILTRHGGLGMEFSVWQQFWRLLGVDQF
QINGIRVKYWEPDESFVKSFEAVSTPLFTKDDCPLPVVGSGQWGGQAPETYARTGHTTDL
LYLCGGGIVSHPGGPGAGVRAVRQAWEAAVAGIPLADYARDHPELAQSLEKFADGKGA

BLAST