GenomeNet

>smel:SM2011_c02736 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) tdk; putative thymidine kinase (A)
MSKLYFSYATMNAGKSTLLLQAAYNYQERGMRVVMLIAAFDDRAGQGRIASRIGLESEAI
PFRAEDDLHGLIERLNGDGSGEIACVFVDEAQFLGEDQVWQLARVADRLGIPVMAYGLRT
DFQGKLFPGSMALLAIADELREVRTICHCGRKATMVVRLDGRGKVMREGAQVDVGGNEKY
VSYCRRHWDDRMREG

BLAST