GenomeNet

>smf:Smon_0005 K01186 sialidase-1 [EC:3.2.1.18] | (GenBank) glycosyl hydrolase BNR repeat-containing protein (A)
MVNMNRKILMFFILSTQLLNALGSYNNGFFDGFKEENLTKVKYDNSTYPTEGQIGKPENN
GKWPGIGPNGEKEGTATLLYTRIPSIIVTNDNKIIVMYDLRWNNPKDPGNNTREKIGADH
GRIDQGISISEDGGKTWKTKTGIKFDDIWRYGKRTAPQKYRRRLMDSTLIYNHLTDEILS
LHGSWNEFTGGNWYAKREDYYNKEIWAALMHKSIDGGKTWERTHKFDKNNNGLFKEHSPD
NPVKAFLGGVGTGIVMRDGTLVMSVQTAHENKGMGKKAIGATLMYSRDGGKTWQMPKIDN
SKILMPNSSSLENMLFEMDGKLVITGRGIDTSNNSGQRNNKQRNNMNNKHRWAYYTEDMG
QTWKKFEPLHTFQTVTSQATQGSTLYVTLPSGKKVILVSAPKGNGNDSWKRGNLALYALS
GKDKNHMKEITLIKPGSGNALGAGYSSLAYKGGNLFAAYEDNGDISVKNLTEYIAEIEKL
ATEWGLEDERAKDIKKVKELKSLTTKQKELLEKAMMEDNDRAFTEAMVLNTELEELDKNV
AKYSKELEDNKEALPSSIRRFNSAIEGLKGEKRDNLVKVLKTRIIKAEVDDTGENIKDVM
DFDLYKPVAEKFLYKRVDIAENDDNIFAGFGVKVGSTDNYFKFGYNHDISNFKLGGFFEI
YESKINARNISVGTTFKTVFENKHTFKNFIRYRHQSLYNLKINNKNDRYNDVILHNLDFY
SSYETKLNLNKNISITPKAGILLTYSHEALLDEDARLDRRIGVSTDISVKAELKHKNTKF
KIKPEILITDNAKYISQTNLSNKRDKTDNKILEYNIQFGISAKVNGINLDLDLDLNDTSK
NRNKTNVRLNFMSGYSW

BLAST