GenomeNet

>smi:BN406_00784 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) DNA polymerase LigD ligase region (A)
MFSQPKESIRLFAGLCVNGLMTKASSKKPRYTPPIDPMPARVDPCLAALVTKPPKGPDWA
YEVKWDGYRIAVHIEPGRVRILTRGGYDWTERFPTIVDDARRLAVKTAILDGEAVVLDDL
GRSDFGMLQRALGRLPSAVEAGAIVFYAFDLLYLDGRDLRRLPLRERRRLLEPLVAGREG
AVRLSEEVQADGNEFFRVACQHGLEGIIAKHIEKPYRSGRGEWWQKITCKRRDSFVVVGF
EPSTVPSHLGRLLLAARKGDDLVYVGGCGTGWSHELSRELRKLLEGMVTKAPAVALRRKG
AVFVDPVLAAEVEYRAWTDDWKLRHASFKGVRPREDEAAVFELP

BLAST