GenomeNet

>smi:BN406_02246 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) tdk; thymidine kinase (A)
MSKLYFSYATMNAGKSTLLLQAAYNYQERGMRVVMLIAAFDDRAGQGRIASRIGLESEAI
PFRAEDDLHGLIERLNGDGSGEIACVFVDEAQFLGEDQVWQLARVADRLGIPVMAYGLRT
DFQGKLFPGSMALLAIADELREVRTICHCGRKATMVVRLDGRGKVMREGAQVDVGGNEKY
VSYCRRHWDDRMREG

BLAST