GenomeNet

>smi:BN406_06279 ribulose bisphosphate carboxylase-like protein; K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MQRALPVIRITYRIETPGDVEVLAKKIASDQSTGTFVPVPGETEELKARAAARVMAIRHL
EPADRASWPDEAGSATRFNRADAEIAFPLDAVGTDLSALMTIAIGGVYSIKGMTGIRVVD
MKLPPEFAAAHPGPQFGVAGSRRLTGVESRPIIGTIVKPALGLRPDETAVLVGDLLCCGV
DFIKDDEKLMSPAYSPLSARIAAIMPRILDHEQKTGKKVMYAFGISHTDPDEMMRNHDLV
VAAGGNAAVININSVGMGGVAFLRKRSGLVLHAHRNGWDILTRHGGLGMEFSVWQQFWRL
LGVDQFQINGIRVKYWEPDESFVKSFEAVSTPLFTKDDCPLPVVGSGQWGGQAPETYART
GHTTDLLYLCGGGIVSHPGGPSAGVRAVRQAWEAAVAGIPLADYARDHPELAQSLEKFAD
GKGA

BLAST