GenomeNet

>smi:BN406_06658 hypothetical protein; K00111 glycerol-3-phosphate dehydrogenase [EC:1.1.5.3] (A)
MTVGATRLDTVRQHYPVLIIGGGINGCGLFRDLAAQGIDCLLVDKNDFCSGASAAPSRLI
HGGIKYLETGEFRLVRQSAMERNLLLKNAPHYVKSLETVLPVYSWFGGIVPSIKRFFRLK
ATLNDRGAIITEIGLRLYDLFGRHFRTMPNHRMLLRRSIAPIMPELTKRAVAAGIYYEGR
ITHAERLGLELLLDGMQDNPASRALNHVSVSGSSGGGIVLTDGLSGRSVTVTADVVINAG
GAWIDAVNDKLGIVSQHMGGNKGSHLIVRNKRLHEALGGRMIYFGSADGRVNLLYPFMEN
VLVGSTDIPVQDPDLAVCDDAEREYLSNVTREVFPDIEIRQDDIVMTYCGVRPLPRTEGV
DPGAVSRDHSIARDVIPGANTPVLSLIGGKWTTYRGFSEEAADLVLNLLGLTRSRSTRDL
PIGGGRGFPMNDAGINRFTDDLSKATGSVQTAADLLHRYGTRATLIAAENNQTRLVSIPA
YGRFELAWICRNESVGRLTDLLFRRTDIALSGRLSAAVVAEAAEIAADTLGWDAERKKNE
IDATLQTCHSHGMAIS

BLAST