GenomeNet

>smk:Sinme_3145 K01113 alkaline phosphatase D [EC:3.1.3.1] | (GenBank) Alkaline phosphatase D-related protein (A)
MAALRNTLTRRSFLFSAGAAGLVASSGLATPFYARGYGRPEFAHGVQSGDVDTGSGMIWT
RVDRPARVSVEYSTTESFSNAVRLADIDATPLTDCAVKCRLHNLLPDQDIFYRFIATDLY
DANRVSEPVVGRFRTAPLRRRSVRFVWSGDTAGQGWGIDEVGMKTYSTMRLHEPDFFIHS
GDTIYADNPIPDEIKLRDGGMWKNRIVTPEKRDVARTLEEYRGQWKYNLLDEHVRRLHAE
CPTFYQWDDHEVLNNWSASTDLSDDPRYPEKDVAVYAARAARAFHEMTAIRTLPTEPGRI
FRKIAYGPLLDVFFVDLRSYRGPNQEEGGGGLFGWRQADWLKRELAASSATWKVIACDMP
IGLIVWDDYSARRGSDAIADGDHGAPKGRESEFADLLRFVRDNAIENLVWLTADVHYTAA
HHYDPSRAAFKDFSPFWEFVSGPLHSGTYGPKEPDMTFGPEVRFMKASGGGIDSNLPPSA
GLQFFGIVDISGQTRQMTVRLMDRQDQELWRVTLDPAVSA

BLAST