GenomeNet

>sml:Smlt2530 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) putative DNA ligase family protein (A)
MSLVEYRRKRRFDQTREPEPGKALPEGQRAIFVVQLHHASRRHYDFRLQVGDALKSWAVP
KGPSYDPKVKRMAVEVEDHPVDYAAFEGEIPKGQYGGGHVAQFDHGVWATQGDPEAQLAK
GHLRFELFGAKLKGGWHLVRSGKPARQPQWLLFKDDDEFASDIEADDLLADVAVAPPEDL
KRAGAGKTAKKKLTVVSPTRTRRKNWAKKALALGKARRAAAPSGPFEPQLAKLGDAPPQG
GQWVHEIKWDGYRILATVAEGNVQLWSRNALEWTGKLPEIRDAIAALGLTSAALDGELIA
GAGTKEDFNLLQATLSGERQGVLTYALFDLLHLDGVDIADAPLLERKALLHSVLEGQGRP
LAFSSHVQGDGDEAYRLAGEQHFEGIISKRADRSYHSGRSEDWRKTKQLASDEFAVVGYT
APKGSRTGFGSLLLARPDPKHGWLYVGRVGSGFSDELIGEVSRRIEGGGGRKPTAHVPTQ
DTDLRAATWFAPRFVVEVFYRGIGGQKLLRQASLKAVRADKDIADLEDSDRAGKAPAAGG
THAPSRPGRRAKKPPATGRTPPALSSPGKILFPGDGYTKQEVWDYYAAVMEHLLPEVVDR
PLSIIRCPSGTAKPCFFQKHHTAGLELVDPVRLKEESGINAHYLVVRDAASLLELVQFNA
LEFHPWGSHAEAPDKADRVVFDLDPGPDVPFAEVKKAATDIRKLLAQLQLESFLRVSGGK
GLHVVVPLNPGCDWDLTKRFAKGFADALAQSEPQRFLATATKSLRNKRIFVDYLRNGRGA
TAVASYSLRARPGAPVALPIAWGDLAKLKRADAFTIKDVPAKLKRRRKDPWAGIGEVKQN
LARWAQADP

BLAST