GenomeNet

>sml:Smlt2530 DNA ligase family protein; K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MSLVEYRRKRRFDQTREPEPGKALPEGQRAIFVVQLHHASRRHYDFRLQVGDALKSWAVP
KGPSYDPKVKRMAVEVEDHPVDYAAFEGEIPKGQYGGGHVAQFDHGVWATQGDPEAQLAK
GHLRFELFGAKLKGGWHLVRSGKPARQPQWLLFKDDDEFASDIEADDLLADVAVAPPEDL
KRAGAGKTAKKKLTVVSPTRTRRKNWAKKALALGKARRAAAPSGPFEPQLAKLGDAPPQG
GQWVHEIKWDGYRILATVAEGNVQLWSRNALEWTGKLPEIRDAIAALGLTSAALDGELIA
GAGTKEDFNLLQATLSGERQGVLTYALFDLLHLDGVDIADAPLLERKALLHSVLEGQGRP
LAFSSHVQGDGDEAYRLAGEQHFEGIISKRADRSYHSGRSEDWRKTKQLASDEFAVVGYT
APKGSRTGFGSLLLARPDPKHGWLYVGRVGSGFSDELIGEVSRRIEGGGGRKPTAHVPTQ
DTDLRAATWFAPRFVVEVFYRGIGGQKLLRQASLKAVRADKDIADLEDSDRAGKAPAAGG
THAPSRPGRRAKKPPATGRTPPALSSPGKILFPGDGYTKQEVWDYYAAVMEHLLPEVVDR
PLSIIRCPSGTAKPCFFQKHHTAGLELVDPVRLKEESGINAHYLVVRDAASLLELVQFNA
LEFHPWGSHAEAPDKADRVVFDLDPGPDVPFAEVKKAATDIRKLLAQLQLESFLRVSGGK
GLHVVVPLNPGCDWDLTKRFAKGFADALAQSEPQRFLATATKSLRNKRIFVDYLRNGRGA
TAVASYSLRARPGAPVALPIAWGDLAKLKRADAFTIKDVPAKLKRRRKDPWAGIGEVKQN
LARWAQADP

BLAST