GenomeNet

>sml:Smlt3530 K10747 DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7] | (GenBank) ligB; putative ATP-DEPENDENT DNA LIGASE LIGB (POLYDEOXYRIBONUCLEOTIDE SYNTHASE [ATP]) (POLYNUCLEOTIDE LIGASE [ATP]) (SEALASE) (DNA REPAIR PROTEIN) (DNA JOINASE) (EC:6.5.1.1) (A)
MKAFAALYQRLDRSTATLDKRAALVDYFRHAAAHDAAWALYLLSGGKVGGARRRIAASGE
LRIWIAEESGLPAWLVEDSYAQVGDLAETLTLLLDDPLHPAADRPLSDWIEQHLLAVANQ
PEVVRRAAVVAGWRQLCSGERLVFNKLLTGALRVGVSQRLVQQALAEWSGLDIARIAQRM
LGEWVPSPALLGQLLSPDELPLDRQQPYPFFLASPLEGEPGERLGPVEDWLLEWKWDGIR
LQLLRRRGEVALWSRGEERLDGRFPEIEQAAMALPDGCVLDGELLAWDESDDLPRAFTAL
QTRIQRRKPGAATLRNTPVRVLAYDLLERDGEDLRGLPLRQRRAQLAEVIGALGDTRIQL
SPDVPAGDWLQAATLREAARERGVEGLMLKRRTSAYQSGRRRGDWWKWKVDPLTIDAVLL
YAQAGHGRRSTLYTDYTFGVWDGDTLVPVAKAYSGLDDKEILALDRWIRANTRERFGPVR
SVRAEQVFELGFEAVNRSSRHKSGIAVRFPRILRWRHDKPAAESDQLATLQALAR

BLAST