GenomeNet

>sml:Smlt3574 K01283 peptidyl-dipeptidase A [EC:3.4.15.1] | (GenBank) putative angiotensin-converting enzyme like peptidyl dipeptidase protein (A)
MKHRHLLLASAIAAATLALAACKKEAAPGTDTASSSAPAGETADQFVARINAEFKAAYPE
MTSAQWLSSTYINSDSERIAAKANERSLTQLNSWIEQAAKFDGKPMSEDSKRAIHLLKLM
SSMPAPRDPAKLAELTQIATRMEGSYGAGKYCTDANDPNSCRQLGELEQVLARSRDYDKQ
LDAWQGWHSTTKSMRGDYQKFVGLVNEGAKGMGFTDAGQMWRSGYDMPPEQIGPETDRLW
EQVKPMYEQLHCYARGKLDKTYGKDKAEVGNGLIAAHLLGNMWQQDWSNLWDQLEPYPGA
GSLDITAALEKQYQTNLSAALAKAGKDANVAAQYKAQREAELRTAKQMTERAQDFYVSLG
MPSLPQSYWEKTQFIKPDDRDVVCHASAWDMNMEGDVRTKMCIKPNEENFTTIYHELGHI
YYDLAYNPLPPLFQGGANDGFHEAIGDTIVLAMTPKYLSSIGLVDAPTESREAVINNQMR
MALSGVSFLPFGLMIDRWRWGVFDGSITADNYNKAWWDLKAKYQGVAPASTRGEEFFDPG
AKYHVPGNTPYTRYFLARILQFQFYKGLCDASGYKGPLHECTFYGNKEAGQKYWAMLSKG
ASQPWQATLKELTGTDKLDAGPMIEYFTPVNEWLKQQNEGQMCGWQANAAPAAK

BLAST