GenomeNet

>sml:Smlt3574 angiotensin-converting peptidyl dipeptidase protein; K01283 peptidyl-dipeptidase A [EC:3.4.15.1] (A)
MKHRHLLLASAIAAATLALAACKKEAAPGTDTASSSAPAGETADQFVARINAEFKAAYPE
MTSAQWLSSTYINSDSERIAAKANERSLTQLNSWIEQAAKFDGKPMSEDSKRAIHLLKLM
SSMPAPRDPAKLAELTQIATRMEGSYGAGKYCTDANDPNSCRQLGELEQVLARSRDYDKQ
LDAWQGWHSTTKSMRGDYQKFVGLVNEGAKGMGFTDAGQMWRSGYDMPPEQIGPETDRLW
EQVKPMYEQLHCYARGKLDKTYGKDKAEVGNGLIAAHLLGNMWQQDWSNLWDQLEPYPGA
GSLDITAALEKQYQTNLSAALAKAGKDANVAAQYKAQREAELRTAKQMTERAQDFYVSLG
MPSLPQSYWEKTQFIKPDDRDVVCHASAWDMNMEGDVRTKMCIKPNEENFTTIYHELGHI
YYDLAYNPLPPLFQGGANDGFHEAIGDTIVLAMTPKYLSSIGLVDAPTESREAVINNQMR
MALSGVSFLPFGLMIDRWRWGVFDGSITADNYNKAWWDLKAKYQGVAPASTRGEEFFDPG
AKYHVPGNTPYTRYFLARILQFQFYKGLCDASGYKGPLHECTFYGNKEAGQKYWAMLSKG
ASQPWQATLKELTGTDKLDAGPMIEYFTPVNEWLKQQNEGQMCGWQANAAPAAK

BLAST