GenomeNet

>smm:Smp_140390.2 mixed-lineage leukemia protein mll; K11422 histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43] (A)
MSSVRPISFTAAKLLWDPELNPSCRTPLYRVDGIVEGRNEPDPDPVVDPRRPLHFRNFCK
KTIVDLPIPSFKIDLYYVGEKPEKEVTFSNLNDNITFKNLEDMCRKFGTIIEAKIYYHPK
SQCHLGIGTVVFTSSKSARACVEHLNQTSKMGNIMTVQVDPFGKIRIRLIAEQMADLLPS
NSCGQFQLPEKSFANQIHSHIPSDFSSQGSSNCEVSSHNPTPRQSHTSSNLSDHKAVETL
PQPHCMTTFKSHLFFKASDKQESDLKTHLRPDKSACVLNDDDISEISCAATHWHREASSN
LNIGKSASGVLADQHTLGLEANICVSKKLSSQQDDAKLHESRYCEESLEARIQKLLKLNC
VKPVPELKDTQNTPVVSDSNSKVTCNLPVSSEACISTNVRIKSDDLKRFESPSNQVIQKG
NTHFDLTKNTRVVTSPSSNRRTLLPTPDGPIENTKTSLFNFHRPPLLKTPYKPVDVQEVI
RIIDDVHMVFVDELRGIIHRDITRKLVEGQAFKLFSDWWDSKEQDCRQNHASSHHNTKEE
SVSSHSVDHPNTSHDSTVPSYQNQSVSGNMSNSSFAPTSVSSSIPVSTMSDSNSVSSNFK
LFGLGMFTTLRSALPKIKRKPRPPSPGPIPLNTVASTSKTESLTICQDGQNVNFRSKIDL
KLEGSPVWKNRGSLMQKASDTSSSDENNGEVNIRGKVSESSGSESSMEQTDQITSDRVRN
RCSPKEHQDKHGYHHVRKRSGTSRLNDKYEYVRSQSKFPSKSSHFSENIRTSDYTSSDND
SELISPSKSFQHIKSRREHARVSDVFSKSDSKSPVGSSLPSDSESSDLSTEPQNNPDEAR
RFTKPSPDELSEISDFKTDSPNRGRLSLLETSQFESTQNRNSNDSLSSPISSQPECALDS
EENEDTQLTVAGKIQKPESSTAFQRSPVSKPVCPVQEVQRRRGRPRKKNQLSPKYSSNFS
PQKETFGFEDSLVSTESSSEDDMFKTNDDSSRDFSTCDNIPSKVNQVNHQSNTDWSILRA
SLEFQPSDFTAIPLTYNSQPSGGSRRKQNLGGLCRNNMALSTVDQNNKYTSFPDTDIPQK
MSLISDHRYPLYHSPGFPASVNSRDRDNLKLSEKYLKSDDLDGESTDSASMESVDIVETV
ECKYMWPESLLTEHNYFRVPEIGSVIHYRSTRKVAKHNLKSKDSFVDGHLTTADNLRKRS
WPTDPMYISGDVSDDDSQGSSKWFKLSKRSNVSELRNEEVPGSCKADLKANKLLTDENKK
LKYIEAKPETSKVRGSRELASLLAPVPRSEIRRVMGESCGLLKEEMYKRMSGEQGFSRSQ
PHFQPRSASEEDYILRSIFVFGIDAEDLSFMCEAYQFLLSKCHSPLDINSHENSKQDNYY
MNAKVIDPRVVNIINLSHWVEHPPTLAADPITVTTHVNNNGHLVNSRNLWSGRQKPERQR
YQDKLLCSKNSTSKLSSVHHKSFARSSDSDDLNSSLSDQPLNYSSDEKHKKDLSNSSVCK
KECSPTYSPVNTSYNHKLRLSWPKFDDQILAVANYAASLNENVDAVGDSVDIHLGPAACL
PPIHSSGSARTQGYYRMPTEERFRRPWCVGRSLIGEDGRRRPIPLMPATVQAQLGGDAAL
QAIGENIEERLTEQASEAKKKQLTQFREARSVQRRLLAEFQDIETGDLLKFNQLKFRKKQ
LIFAKSPIHAWGLIALEPIAAEEMVIEYVGHVVRKGVAELREHQYEAXXXXKLFTESIFL
VLMSLRFYLYPRQNTFYYHSEFYLHPNCYAKIIMVESKKKIVIYSKRDINVMEEITYDYK
FPYEEDKIPCQCGSSSCRGTLN

BLAST