GenomeNet

>smm:Smp_140700 serine/threonine protein kinase; K04468 nemo like kinase [EC:2.7.11.24] (A)
MLVPINFPYSAETYQKQFLNPSTPLPGSLSVFPNVLHYSEKVAAMFNGLQIGPSLRCANL
IPQKGPQHIIGGPVLAVVKSTFSPVGYGNSQRLENGFTFQPSLTQKVYMPEKSLGFGAFG
VVWLVVDPRTGDQVALKRIPNIFESIVSAKRAYRELKLLFSLRHSNIVRLIDVVKVSSSS
LFSEVSVLCEYMDTDLHKIIVSTQYLSLEHVKLFVYQILRGLKYLHSAGVIHRDLKPGNL
LVNSDCLLKICDFGLARSVPSFDVESPSNPLTLEVVTQFYRPPELLLGSNFYTAAVDQWS
VGCILGELLCRQILFQSSSSFRQLDMIFNLLGSPNAMELIDLVGFPSSSIDFIRNCPVRP
FNHAAVSRILVPANTQYFQSSTENPPDPDLVNLFTGLLSFSSSKRLTAEQALDSPFLIGG
RARFHTCLCSCCPPRNQNSIINDSSSHWRNVTNQVNRHHLVAVGSVGTLSSSGGTPPSSL
HSSMLSQSRDITLRIPLFLSPHLMVPTSLIRYRRINLEPTFQDIHEYTYINTEIQMNNLF
EAKQILWNLIQQYFQRDPNRTRVVINNSSPNFQSFIK

BLAST