GenomeNet

>smm:Smp_160700 SET domain protein; K11424 histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43] (A)
MSLIQQQRPQLTLVFSDMQSINNIVSEHISTDSLCYKLDPLPDFHSKEISIKRSPDPYPN
EFRSLNPQHDDDLYKSVFNNVRSLDEPEANSVHSPEETQILTNVNGFWKQENIKWSSNSP
KFSPPTSPSFSYQSISSDCPSDEPEHKPQPFLRSRQDSSSEEASRVDEVKEDIKSVRPTF
MRHMQFRTKIRSQWKRNFNKSNIVRSSLTSAARKKALLAKAVSRKLIYSQLSKSTSVQLN
HCQEPWQVGELVWARPYWPENLPWWPAIVTEKPKKYQVRGFGLKSTHDFNDVTVPKFRVC
LLGIIRPLTFLTLPQTRLRLFSGREEFESFLRQTVLEAKDKVRALRQFTVQPSLQSAWHH
AREAAVAAKLTKPEPTDRLALFPWATEPSFRKLDPLSEFVRKNTGKFTLSSKSRKRPYRE
EASEGGSFLSSSSDDSATSVASDSDIDSKGRHHRPSSYISSSTSTSSIGHRKRLKLSNDS
SKNEKIGQRWIDLANSFEFEKLRFGHTTPKHHFMCSVCGEFNNNISVTTNNSHSTVNTIQ
PILSDVVHTTLLDSQRNCNQVSQQNLGKLDNLTHPDPHLLTLQGSSCSETPSVDHATSDS
SVVDKNISEVNIKIEDGVTDNNSHQKDIQLISEPSKSELPRSGDQMIRCSVRACRRWYHP
SCLRKPPFAVVVREGRSGSFTCPAHTCLACSAETPGTMPRPSPHFIRCVMCPAAYHPGDW
CLPAGSKEIAPNLIICPRHALQDECKLYTSPPNIQLKLPSSGLLNMFRPTNVSWCFICSK
GGRIICCESCPASFHEECLKIDEVPDKFICEDCTNGRMLRYGEIVWARELVHPRHLQTSQ
CHVQSENQAVTINFQPTTSPTSHSFNHILGSVLVRLFGLTGRLSHRHSRPVYLWTTRARL
FPYEEGDDKRGSHSSRRKKFIYNAALKQAARGYLKRHEKFSELLGRTRRPDYYKPIKVNW
PLGSVRIYRLTDPSEAPRCECKPNSEDPCGPSSNCINRELHYECLPSICPNGDACRNQRF
TKRLYPPQRPFWTGDQRGWGLKTMIAIRAGEFVNEYIGDLIDEDEANRRLRFAHENNITN
YYMMKLDSQRIIDAGPKGNLSRFMNHSCDPNLNTQKWTVNGDNRIGLFAVRDISVGEELT
FNYNFVALGQERLNCRCGASNCVGFLGARSESSNNNNGNGQAGGNSSHYGESNNSSNALI
NTDISRGSSKRHTAQTNPRSNDIDKSYVKDGRDICPSKVSNHNLSTTSLVNNNKNGSINV
NSPLNMNRRHETKCFRCGEKYAPVGKRSLSLFSETLNLTNSSHTNTTVVPSSSLSSSKSL
SKRGLKRELEDLVASVVNHSPSKSQHGLSSPTLTNRNETQSLTFISTTNSTTTEDQTSYK
SSDLILCSKHDCSKAYHLFCLDLDTPPQGQWFCPWHHCDACGRPSHIFCSICPSSFCLAH
VEGSIVVLPPVLPKRNRKLSNNRSENNVDPIENGKFYALLARENRKQYVLINISGYKLNG
SVLSKEKKRYFSNRHYFLELELNFASNLSTSSNYFDIMLKNSMSTLVLPNFHSTSENCLN
FQDSLNVESNLPNLPPVSNWNYEDTTTYISNLNLQNSIPNIIDNHMISHYQSTQNLLNSS
KQSLPSSLLLPSYADSGCLSLNDETSMINVNHSTSTPVHIVDNDSTTPTSHISTTTISPI
NIDSLDNMMNETQIIVVSPNNNQTNSITIKDHSKITTTVNPSTITKPAEEEKERLNMREK
DKIGMS

BLAST