GenomeNet

>smn:SMA_0963 tdk; thymidine kinase; K00857 thymidine kinase [EC:2.7.1.21] (A)
MSLLAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDGYGVVSSRIGMRR
KAIAITEEMDIFAFIQELPEKPYCVLIDECQFLTKKHVYDLARVVDDLDVPVMAFGLKND
FQNELFEGSKYLLLLADKIDEIKTICQFCSKKATMVLRTENGKPVYEGNQIQIGGNETYI
PVCRKHYFNPMISKEK

BLAST