GenomeNet

>smo:SELMODRAFT_111860 hypothetical protein; K11430 histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43] (A)
MAALSATFTRLKKQVAFERQAYVKARMDANSERLQGFCTHLLALSSSRAVNNRNHADNDM
LNTRIQKALNKLGTDPAAADQQCGSQDDSSAPILFNNSGGKSIVKPVRLQTVQKTPPYTT
WIFLDRNQRMAEDQSVVGRRRIYYDSAENEALICSDSEEEQVEEEEEKRDFSKGDDFLIR
ATVQEHGSSKMVFKALADCLDAKPSEIEARYEILAKDGDKLKSEEKHDLLSAMDSFDNLF
CRRCLVFDCRLHGCSQPVIIPFDKQTPLNKTGELPSVPCGPCCFHLPRLSSHHDATSSGV
ESKPVPVESTAPAIEKSWQVPDSKDKGVATEPVAKTVDKPPEAPKKSFKDKSVTALRRLL
LKRKATRHTDDDTNEARKKHHVEGSHAEVGDGSGNATRGENTGASMYLKKLVSKKLYAQR
KWKGSQITTVKRPPPVIKESEDVMQSISKNLTLYDSNWNTLEKDLYETGLQIFGRDSCLI
SRNLLRGMKSCAEVGEFMQLEAAVNWKLNEETKLQQDGNTVIEDATIDRSRSRLYNGRRR
GRVRRLKYTWKSVGYPAIRKRLVDGKDGCRQYTPCSCSESCGKQCSCHRNGTCCEKYCGC
SKNCKNRFRGCHCAKSQCSSRQCPCFAAGRECDPDVCRNCWIGCGDGSQGGPPARGDSYE
CRNMKLLLKQQQRVLLGRSDVAGWGAFLKTPVNKHDYLGEYTGELISHREADKRGKIYDR
ENSSFLFNLNDQYVLDACRKGDKLKFANHSPNPNCYAKVIMVAGDHRVGIFAKERISAGE
ELFYDYRYEADRAPPWARKPEDGQKNDEAASGSGRAQKTA

BLAST