GenomeNet

>smo:SELMODRAFT_121442 K00627 pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12] | (RefSeq) hypothetical protein (A)
MLLFLSILCLTDHVFFSCLVPSHQPLGMPSLSPTMTQGNIVKWKKKEGDKVTAGDVLCEI
ETDKATVDMECMEDGYLAKIVFSDGAKDIKVGQIIAITVEEQGDIDKFKDYKADAPAAPP
KPAPKESPPPPKPTESPKPAPSPKPAPAASGDRIIASPNARKYAQDNQISLSGVAGTGPG
GRIVRADLLIVVFIGGQQVQEPRRAETPGDSTSLDYTDLPNTQIRRVIAQRLLQSKQTIP
HYYLTVDVRVDKLLALRTQLNAKLEKEKRKKLSVNDFVLKAAALALKKVPECNSSWTDEF
IRQFHNINISVAVQTERGLMVPVVKDADKKGLGAISDDVRTLAEKARENTLKPSDYDGGT
FTVSNLGGPFGIKQFCAIINPPQSCILAVGTTDKRVIPGENDGEYTAATFMSATLSCDHR
VVDGAIGAHWLGAFKGYIEDPMTLLL

BLAST