GenomeNet

>smo:SELMODRAFT_152569 K00164 2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2] | (RefSeq) hypothetical protein (A)
MQTAAASAPRSVPLSRLTDNFLDGTSSVYLEELQRAWEADPKSVDESWDNFFQNFTGKAA
SSPGVSGQTIQESMRLLLLVRAYQVNGHMKAKLDPLGLDERVPPEDLNPALYGFTEADLD
REFFIGVWRMSGFLSENRPVQTLRAILKRLEQAYCGTIGYEYMHISDREKCNWLREKIEQ
HVPSKYSKERQITILDRLIWGTKFENFLAQKWTAKRFGLEGCETLIPGMKEQIDRAADLG
VESVVIGMPHRGRLNVLGNVVRKPLRQIFSEFAGGTKPAESGYSGSGDVKYHLGTSYDRP
TRTGKHIHLSLVANPSHLEAVDPVVVGKTRAKQYYSDDYERKKNMAILLHGDGSFSGQGV
VYETLHLSDLPNYTTGGTIHIVVNNQVAFTTDPRSSRSSPYCTDVAKALNAPIFHVNGDD
VEAVVHACELAAEWRCQFKADVVVDIVCYRRFGHNEIDEPSFTQPKMYQVIKNHPTSLEL
YEKKLIESGQISEETVKKIHDKVYGILSEEFESSKDYVPKTQDWLAAYWSGFKSPEQLSR
LRNTGVKPEVLKNVGKKITTLPPSFTAHRAIKRVYEQRAQMIETGDGVDWATAEALAFAT
LLAEGNHVRLSGQDVERGTFSHRHAVVHDQETGERYCPLDHVVTNQKEEMFTVSNSSLSE
FGVLGFELGYSMENPNSLVCWEAQFGDFSNGAQVIFDQFLSSGEAKWLRQTGLVCMLPHG
YDGQGPEHSSARLERFLQMSDDHPFVIPEMEVSLRKQIQECNWQVVNVTTPANYFHVLRR
QLHRDFRKPLIIMSPKNLLRHSSCRSNLSEFDDVQGHPGFDKQGTRFKRLIKDKNDHGTV
EPEIRRLVLCSGKVYYELDEERERVGAKDVAICRVEQLCPVPYDLLQRELKRYPNADVVW
CQEEPMNMGAFSYIAPRLGTAMLSVNRGSFGDIKYVGRPPSAATATGFAAVHKMEQTELV
QKALQAQKM

BLAST