GenomeNet

>smo:SELMODRAFT_153081 hypothetical protein; K02358 elongation factor Tu (A)
MATFTRTKPHMNIGTIGHVDHGKTTLTAAITKVLASEGRAKAIAFEDIDKAPEERKRGIT
ISAAHVEYETANRHYGHVDCPGHADYVKNMITGAAQMDGGILVVSAPDGPMPQTKEHILL
ARQVGVPSLVCFLNKVDAVEDEELLELVEMELRELLSFYKFPGDDIPIIRGSALQALQGT
NDETGKNSILKLMEAVDTYIPEPKRVLDKPFLLAVEDVFSIQGRGTVATGRIEQGVIKVG
EEVEIVGLKESGPQKSVVTGVEMFKKILDQGQAGDNVGLLLRGLKREDISRGQVICKPGT
IKTYKKFEAEIYVLSKDEGGRHTPFFSNYRPQFYLRTADVTGTITLPENVKMVMPGDNVS
LKFELRVPAPIEAGQRFALREGGRTVGAGVISKVIPG

BLAST