GenomeNet

>smo:SELMODRAFT_153081 K02358 elongation factor Tu | (RefSeq) hypothetical protein (A)
MATFTRTKPHMNIGTIGHVDHGKTTLTAAITKVLASEGRAKAIAFEDIDKAPEERKRGIT
ISAAHVEYETANRHYGHVDCPGHADYVKNMITGAAQMDGGILVVSAPDGPMPQTKEHILL
ARQVGVPSLVCFLNKVDAVEDEELLELVEMELRELLSFYKFPGDDIPIIRGSALQALQGT
NDETGKNSILKLMEAVDTYIPEPKRVLDKPFLLAVEDVFSIQGRGTVATGRIEQGVIKVG
EEVEIVGLKESGPQKSVVTGVEMFKKILDQGQAGDNVGLLLRGLKREDISRGQVICKPGT
IKTYKKFEAEIYVLSKDEGGRHTPFFSNYRPQFYLRTADVTGTITLPENVKMVMPGDNVS
LKFELRVPAPIEAGQRFALREGGRTVGAGVISKVIPG

BLAST