GenomeNet

>smo:SELMODRAFT_161472 K01805 xylose isomerase [EC:5.3.1.5] | (RefSeq) hypothetical protein (A)
MRMGRRSICLASFVALLCLGSTLATQEKRVADQTCGSGFQEGEVEFFPNISKIEYEGPSS
KNPLAFKWYNPEEEIYGKKMKDWLRFSVAFWHTFRGDGSDPFGSPTKQWPWDDGTDSLEM
AFTRMRANFEFLKKLGLNRWCFHDRDIAPEGRTLEESNANLDKVVALAKQLQEGTDIRPL
WGTAQLFKHPRYMHGAATSPDARIYAYAAAQVKKAMEATKELGGENYVFWGGREGYQSLL
NTDLERELNHLGQFLKSAAEYKKKIEFDGVLLIEPKPQEPTKHQYDWDAATAIGFLQKYG
LKDDFKLNIECNHATLAGHSCYHELEVSRINGVLGNIDANTGDAQTGWDTDQFLMDIAET
TQVMLSVLQNGGLAPGGFNFDAKLRRESTDVEDLFISHIAGMDAMARGLRNAAKILEEGT
LPSIVKERYASFDSALGASIESGELGFEELEQEALRMEEPLPASGKQELAEMVFYNSI

BLAST