GenomeNet

>smo:SELMODRAFT_232379 K11420 euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43] | (RefSeq) SDG33-1; hypothetical protein (A)
MRLKTPGMSADLADLAKVGAEGDVDVENGQALSKSGNFVLGDAAKVKNNLRIFNMCYLQA
IKEEQERCKKMRNASQRPDLKAISKMLRMNAILFPEKRIGDLPGVKVGDTFFSRAELVSV
GIHKHWINGIDYIGKGGNDHKTYNLPLAISIVMSGGYEDDVDNSDDVIYTGQGGNNLAGD
RRQMQHQEMKRGNLALKNSIEEGNPVRVIRGHDLRHSYTKRVYTYDGLYKVVDYWAERGI
SGFKVYKFKLRRCEGQPALTTEQVRFCRGKLPVAPSERGLVCKDISNGLEVLPVPVSNLV
DNPPCAPDGYRYINKIEIDDGIVLPPPALGCSCKGLCVDPKICSCAKRNGHTFPYVDSHG
GRLAVPLDAVYECGPNCGCGPACINRVTQRGLRYRLEVYKTQHKGWAVRSWDSIPAGAPV
CEYFGKVIKSDSLDVKSDVYLFDLDCIQTMRGVDGRQRRWGDLNKFLDDQNGKVSCESKD
AEDAEHHGQAEFCLDGGECGAVARFINHSCEPNLFIQCVLSTHHDMRIPRIVLFAADNIA
PLQELSYDYGYALNSVVDSDGLVKKLPCYCGALSCRKRLY

BLAST