GenomeNet

>smo:SELMODRAFT_269350 hypothetical protein; K00844 hexokinase [EC:2.7.1.1] (A)
MGKAAVTITIACAAATCAAVAAAFFVNRRLRQRTSWKRAQCIVDEFRGGCSTPLSRLRQI
VDNMVVEMHAGLAIDGGSKLKMVLSYVDNLPTGNEEGLFYALDLGGTNFRVLRVQLGGKE
KRIMNQEYKEVSIPPKVMVGSNEDLFDFIATELASFVASEGEGFYLLPGQQRELGFTFSF
PVKQTSINSGTLMKWTKGFAIAETVGKDVVEELQGAMHRSNVDMRVAALVNDTVGTLAGG
RYEDDDVMVAVILGTGSNACYVERADAIPKWRGPLPASGSMVINMEWGSFTSAHLPKTEV
DDALDADSVNPCDQIFEKMISGMYLGDIVRRVLWKLAAEAAFFGGKVPSRLEVPFILRTP
DVSAIHADQSPDLKEVIRVLRVVFGIQSSTLQMRKMIVDVCDIVAERGARLAGAGIVGIL
KKIGRDGGSLANNGGLENHSYAAAEERKKTVVAMDGGLYEHYPKFREYLKQSVVELIGKE
AAEHIELRLSKDGSGIGATLLAASHSSFVAEQE

BLAST