GenomeNet

>smo:SELMODRAFT_403348 hypothetical protein; K00857 thymidine kinase [EC:2.7.1.21] (A)
MFAGKTTVLLQRIQAEADAGRRVALVKSDKDTRYGLGCIVSHSGKKMHCAAVASLSDFKS
HKPELYAQAEIIGIDEAQFFDDLLSFCQSAADWDGKTLIVAGLDGDFLRQRFGSALDLVP
LADSVTKLSSRCEICGRAAAFTFRKTDDRRKEVIGGADIYMPVCRKHYVNGQFAMEAARS
VVLESHSPQRDPCSSSPERKLAIG

BLAST