GenomeNet

>smo:SELMODRAFT_446978 K11430 histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43] | (RefSeq) hypothetical protein (A)
MQSMEEGEASGKVSMAALSATFTRLKKQVAFERQAYVKARMDANSERLQGFCTHLLALSS
SRAVNNRNHADNDMLNTRIQKALNKLGTDPAAADQQCGSQDDSSAPILFNNSGGKSIVKP
VRLQTVQKTPPYTTWIFLDRNQRMAEDQSVVGRRRIYYDSAENEALICSDSEEEQVEEEE
EKRDFSKGDDFLIRATVQEHGLSKMMFKALADCLDAKPSEIEARYEILAKDGDKLKSEEK
HDLLSAMDSFDNLFCRRCLVFDCRLHGCSQPVIIPFDKQTPLNKTGELPSVPCGPCCFHL
PRLSSHHDATSSGVESKPVPVESTAPAIEKSWQVSDSKDKGVATEPVAKTVDKPPEAPKK
SFKDKSVTALRRLLLKRKATRHTDDDTNEARKKHHVEGSHAEVGDGSGNATRGENTGASM
YLKKLVSKKLYAQRKWKGSQITTVKRPPPVIKEPEDVMQSISKNLTLYDSNWNTLEKDLY
ETGLQIFGRDSCLISRNLLRGMKSCAEVGEFMQLEAAVNWKLNEETKLQQDGNTVIEDAT
EIDRSRSRLYNGRRRGRVRRLKYTWKSVGYPAIRKRLVDGKDGCRQYTPCSCSESCGKQC
SCHRNGTCCEKYCGCSKNCKNRFRGCHCAKSQCSSRQCPCFAAGRECDPDVCRNCWIGCG
DGSQGGPPARGDSYECRNMKLLLKQQQRVLLGRSDVAGWGAFLKTPVNKHDYLGEYTGEL
ISHREADKRGKIYDRENSSFLFNLNDQYVLDACRKGDKLKFANHSPNPNCYAKVIMVAGD
HRVGIFAKERISAGEELFYDYRYEADRAPPWARKPEDGQKNDEAASGSGRAQKTA

BLAST