GenomeNet

>smo:SELMODRAFT_447920 K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] | (RefSeq) hypothetical protein (A)
MALSLRKMVSIDDRMRLLVPTKVTADDKLIEYDMLLLNHFLSVLKDLHGEEMRELVHRCY
ELSGQYGQAEGCGDPAKLEDLGNLVKSLQPGPAIVIASSLSHMLNLGNLAEEVQIAHRRR
VSEKSGGIGDENSALTESDIEETFRRLMKLGKSPQEIFEALKTQTVDLVLTAHPTQSIRR
SLLQKHSRIRSCLSELYKDDITPDEKQELEEALHREVQAAFRTDEIRRTPPTPQDEMRAG
MSYFHETIWNCLPKFLRRVDTALKAIGINERLPYNVPLIQFSSWMGGDRDGNPRVTPEVT
RDVCLLARLMASSLYFSQIEDLMFELSMWRCNEELRARVAQLELRTKEDAKHYKAAVTEF
WKPIPSNEPFRVILGDIRDRLYRTRERARQILATGKSDVNEEEAFSSVEEILEPLELCYR
SLCSTGDKLIADGSLLDFMRQVSCFGLGLVRLDIRQESDRHTDVMDAITTHLGIGSYRSW
TEEERQEWLLAELRGKRPLFGADLPKTDEIKDVLETFHVIAELPTDCFGAYIISMATAPS
DVLVVELLQRECRVNVPLRVVPLFEKLADLEAAPASLTRLFSIDWYRNRIKGKQEVMIGY
SDSGKDAGRFSAAWQLYKCQEELVKVAKQFGVKLTMFHGRGGTVGRGGGPTHLAILSQPR
DTIDGSLRVTIQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPTAPKEDWRKLMDEMA
AIATEAYRSVVFKDPQFVHYFRMATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAW
TQTRFHLPVWLGFGEAFKDVIDGNPQTLKMLQAMYREWPFFRVTVDLVEMVFAKGDPRIA
ELYDRLLVSPELQDIGKKLRGKYEETRKLLLEVACHSELLEENPTLKQRLRLREPFITTL
NVQQAYTLKKMRQIEPDDAPMPRTNANSASAEELVELNTTTEYAPGLEDTIILTMKGIAA
GMQNTG

BLAST