GenomeNet

>smp:SMAC_01897 K01556 kynureninase [EC:3.7.1.3] | (RefSeq) hypothetical protein (A)
MTASSWPTNNDNHPTNSPAKWKNMSTAAVQDARKQAEALDNEDPIAFIRDEFNIPTKAQI
ASSRLADSHPAALPASKDDAKSVYLCGNSLGVQPKRTVTRLNQYLTTWATQGVQGHFKPL
EESPLPTWLDADAKAAELIAPVVGADVSEVAVMQTLTANIHLLMSAFYRPDINNRHKVIL
ENKAFPSDHFVVETQIRHHSLSTEKSMVLIDSSSKDNIITTQEILSVISAHADTTALLLL
PGIQYYTGQLLDIPAITAFAHKHGIFVIWDLAHAVGNVPLYLHDWGVDAAAWCSYKYLNG
GPGCIGGLFVHTNNSIVTKEITDEKPEEGYSNRLAGWWGNDKKTRFVMANKFHPVAGAAG
FQLSNPSILDITSLSASLEIFQEAGGMEALRSKSLKLTNFLEATLGGMKEEDRAHFRIIT
PSKPEERGAQLSLMLSDGLLDTVMKELEARGVIVDERRPNVIRVAPAPLYNTFSDCVQFV
EAFSAALEAATKRAL

BLAST