GenomeNet

>smp:SMAC_07106 hypothetical protein; K00026 malate dehydrogenase [EC:1.1.1.37] (A)
MVKAVVAGAAGGIGQPLSLLLKLSPLVDELSLYDVVNTPGVAADLSHISSTAKTTGYLPP
NDGAKAAFKDADIIVIPAGIPRKPGMTRDDLFNINAGIVKGLIEVAAEVAPNAFILVISN
PVNSTVPISAEVLKAKGVFNAQRLFGVTTLDIVRAETFVAEIAGKSNPQELVVPVIGGHS
GETIVPLFSKVTPSVTIPDDKYDALVNRVQFGGDEVVKAKEGLGSATLSMAYAGYRFAEK
LLKASKGAKGLVEPSYVYLPGIPGGKEIAEKTGVDFFSVPIELGPNGAEKAIDILGDITE
KEKTLLEAAVKGLKGNIQKGVDFAHNPPQK

BLAST