GenomeNet

>smp:SMAC_07106 K00026 malate dehydrogenase [EC:1.1.1.37] | (RefSeq) hypothetical protein (A)
MVKAVVAGAAGGIGQPLSLLLKLSPLVDELSLYDVVNTPGVAADLSHISSTAKTTGYLPP
NDGAKAAFKDADIIVIPAGIPRKPGMTRDDLFNINAGIVKGLIEVAAEVAPNAFILVISN
PVNSTVPISAEVLKAKGVFNAQRLFGVTTLDIVRAETFVAEIAGKSNPQELVVPVIGGHS
GETIVPLFSKVTPSVTIPDDKYDALVNRVQFGGDEVVKAKEGLGSATLSMAYAGYRFAEK
LLKASKGAKGLVEPSYVYLPGIPGGKEIAEKTGVDFFSVPIELGPNGAEKAIDILGDITE
KEKTLLEAAVKGLKGNIQKGVDFAHNPPQK

BLAST