GenomeNet

>smp:SMAC_08188 hypothetical protein; K01176 alpha-amylase [EC:3.2.1.1] (A)
MGDNFQTPSPLPAQAAEPQQQPTPQNATLLQAFEWYIPPDHGHFLRLSSQIPQLSQHGIS
SLWIPPSCKATSPQSNGYDIYDLYDLGEFSQKGSTATKWGTKSQLLELAQKGQEYGVGLY
WDAVLNHRFGADHREKCKAVEVDANNRNVRISGIPRRLMAKKGNYDYLMGCDLDYSHPEV
EEDVLNWGRWLVKEVPIRGIRFDAVKHFSEGFLRKFVKMLDGEFGEGWFLVGEFWKDSLK
TDYLDRMDHKFSLFDAPLVYNFGEISTSVSADLRKVFDDTLVQKAPVCAVTLVQNHDTQP
LQALAVPITPWFLPLGYALILLREAGYPCVFYGDLYGLCTPTSDNPSPTRPTSGPVTILP
KLLLARKLYAYGPQTDYFDYQTCIGWVRHGTWDRKDKCAVVMSNAAEGWKRMFIGAECAG
QRWTDVLGWRGEVVTVGEDGWAEFRCGGCSVSVWAWDGAKGREEFGGEFDFDIYGSESEG
TN

BLAST