GenomeNet

>smp:SMAC_08815 hypothetical protein; K11429 histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43] (A)
MTKPSGTGGKKKNQLTLAQLAAYDDILTDALVDHAYYWTTIPKNRTSYHPSRGIKEEEIT
KIIQNHLIVDPDISTAEEKLLATDGLKRFANTLKTPREQNDFKAHLRRYMSIYLPDCPFE
VNATNRYTIVTYEASITARRFIKRNETIKYLAGIQVVITPEEELEMSLRKKDFSLIVSSR
SKSTSLFMGPARFANHDCNANARLITRGQAGIEIIACRNIEVGEEITVTYSESYFGENNC
DCLCATCESNLRNGWRPVDGEAVVQKSIEDGEQQQSTDSSTPYSFRRKRRYGSAALQAGS
RTPSVTPDMRPRVLRKSQSQMMLGERMSTTDSGAQGPGTEGRKRALEMGTPPFTPTKKQR
TTTQYPIIPIALSTAPSRGSSDNETSRSPLSFSTTNDNITDATSQGSESPGPIILSPEPT
PIKQAIGVLKQEEGVNEVAVQQVPEAFTPPSSQPTEEQPPVVRPTIERLAVRDRMSIANL
ISGPSSPVPPPIVVSIAQVTTHRPKPRTQQVQKTEQTTTISVSQTATTVSLEPPAQNDAP
VVKTESPVKSIVSQVEQITQIQTTTKSTPSKSKAAKPTALPQHLIPVPAAPTGRVPRDYT
LTPLLLSEPETAWIMCTHCASAFVQKNAYLTKSHCPRCERHSKLYGYMWPKTEKYGPNDK
EERILDHRMINRFLTAEEEARARGRVYWRERMGSKSKGKSAAPEKKGGTPAGEKKEQQQQ
VKKEQSQEQGQGQGQQYVQERFAVRKKVKVQVRSTVPTPLIVTKKDEAAEAAALGLRRSG
RARRISAKLADCELDF

BLAST