GenomeNet

>smp:SMAC_08947 hypothetical protein; K01556 kynureninase [EC:3.7.1.3] (A)
MSDFTSKVEVLRDGQKPEFPSNANTLEYAQSLDAQDELRHFRDEFIIPTRGSLKKRALDG
TIPGVPTPGTTEADTPCIYFVGNSLGAQPKAVRTYLEAQLETWASIGVNGHFSSMSNSPL
APWQDMAADCAAKSAAIVGAADPSEVVMMNTLTVNLHFMMASFYRPTEKRHKIILEWRPF
PSDWYAFQSQIEWHGLDPEKSMVEIQPDENLYLSTEKILKTIDEHAEDAALLLLPGIQYY
TGQLFDIPRITKYAQERGLVVGWDLAHCAGNVELQLHDWNVDFAVWCTYKYLNGGPGSMA
GAFVHERHGKVDMSSGKPVFKPRLSGWYGADKSVRFNMDKEFQPTPGAQGFQISNPSAID
LTSLAAALSVFNKTSMKDLRSKALVLTAYTEHLLDEIVRRQPEGEEPAFKIITPRDPLQR
GTQLSLLLRDGLMDKVAAALEENGVVCDKRKPNVIRVAPVPMYCRFEDVWKFMEIFEGAI
RG

BLAST