GenomeNet

>smp:SMAC_09193 hypothetical protein (A)
MSSYQNGTNGHSASNGANGKAKSSTVIGPDPDAERTASMAKPRPISMNLPFTGASRQGVE
NAFERHRQTIQSAVQPLPTQQGAGTFSENKKWGKLSSDLMTLRWADFKTLKHMAVAKIKG
EKITDDKTMIMEKVIQLVSNLPSNSKLRVELTNSFLSELWYTLEHPPSIYVGEEYQYRKA
DGSCNNIMFPQLGAAGNTYARSVRPNVIRQGALPDPELIFDSVMKRTEYKSHPNNVSSIL
WYWASIIIHDLFWTDYRDMSKSKTSSYLDLSPLYGSNQEMQDTIRTFQDGKLKVDCYADK
RLLGMPPGVSVLLIFFNRFHNYTCDNLIAINEDGRFNKPSPKLEGEKAAAAWKKYDNDLF
QTARLITSGLYINITLLDYVRNIVNLNRVDTTWTLDPRADTGIDVGTKEGAERGTGNVVS
AEFNLCYRWHSCISAKDEAWVEEFYHELFGKPGADVNFHELIMGFSKFEGSIPADPVERA
IPKRNGNFTRDAATGKISDDELAECITEAIEDPAGSFGAKNVPGSMRAIEILGIIQGRKW
NLAGLNEFRKHFGLKPYETFEDINSDPGVSEALRRLYDHPDFVELYPGIVAEEHKSPMVP
GVGIAPTYTISRVVLSDAVCLVRGDRHYTIDYNPRNLTNWGYNEVQYDLNVNHGCVFYKL
FLRALPNHFKENSVYAHYPMVTPDENAKILKDLKRDHLFDWTRPGRQATPHQVTTYAGAK
HVLDNEKEGAYKTAWHAGLESILNRPISTSNSTNPDAHDSQRRDIHEQLYSAEWATHVKT
FFSQTTDALLAGESYNVGGRLLVDLVRDIGNIVPTLFAAKVFDISLQGKDNAKGLYTPHE
LYAVLAVIFAAIFYDHDPVKTYQLRDAARTVATQLGEALEAGVKSQTSFFGSFFGGGGND
DPLTAYGSDLVKRLSKAGLSSSDVAFGQVLPIVASSVPSIAEGFASAVDFYLGEQGKEHL
AAIQELARQPASSAADAQLLGYVLEGIRLSGNNLGAFRQASSVDAIKEEDGGEVRVQPGD
RVFVSVKSAAQSPATFPNPEDVNPSRPLDAYKIFFFGTHSYLGHEVSQIALTAMFRSLFK
RSNVRRAPGPQGQLKKITRELNEKLSQTFYLREDWGAVTPFPVTMKVTWDE

BLAST